PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_022568-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 331aa    MW: 36468.7 Da    PI: 6.5001
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_022568-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+d ++++G+g +W + +++ g++R++k+c++rw++yl
    NNU_022568-RA 14 KGPWSPEEDTKLKDFIEKHGTGgNWIALPHKAGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding36.98.4e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++ +Ed ++  + +  G++ W+ Ia+ ++ gRt++++k++w++
    NNU_022568-RA  69 GEFSDDEDRIICSLYASIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.08962IPR017930Myb domain
SuperFamilySSF466895.85E-2711109IPR009057Homeodomain-like
SMARTSM007171.2E-121364IPR001005SANT/Myb domain
PfamPF002492.1E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-231569IPR009057Homeodomain-like
CDDcd001678.23E-101662No hitNo description
PROSITE profilePS5129421.94863117IPR017930Myb domain
SMARTSM007171.8E-1167115IPR001005SANT/Myb domain
PfamPF002491.5E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-2370117IPR009057Homeodomain-like
CDDcd001674.96E-870113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDTKLKDFIE KHGTGGNWIA LPHKAGLKRC GKSCRLRWLN  60
YLRPNIKHGE FSDDEDRIIC SLYASIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLMGM  120
VPSQRKPSQP ALPTHLQTAS SSPSLPSSSS SYEGSGTYYN PGRSLTGLEP ISIPSNLLSG  180
TNTHTTTPTS TLLQTQESFM SSMHNGYPVN EGLLMFGGEP SCSSSDGSCN QISYGKDMEY  240
EYCGGRGGVA NSEQMDLESF FYNGVSEDQK FMAEGNNGGC GVDGWTQKPN GVWEETPLDY  300
GLEEIKQFIT SNACNSCFFD ENKTQGRVVY Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-27141177108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744721e-112DQ074472.1 Malus x domestica MYB24 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010241795.10.0PREDICTED: transcription factor RAX2-like
TrEMBLU5GA631e-132U5GA63_POPTR; Uncharacterized protein
STRINGPOPTR_0006s12530.11e-132(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.14e-77myb domain protein 36